SCOPe 2.07: Domain d6cqna1: 6cqn A:4-81

Lineage for d6cqna1 (6cqn A:4-81)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries)

8. Domain d6cqna1: 6cqn A:4-81 [353184]
   Other proteins in same PDB: d6cqna2, d6cqnb1, d6cqnb2, d6cqnd1, d6cqnd2, d6cqne1, d6cqne2
   automated match to d1fnga2
   complexed with cl, mg, nag, so4

Details for d6cqna1

PDB Entry: 6cqn, 2.5 Å

PDB Description: crystal structure of f5 tcr -dr11-rq13 peptide complex

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d6cqna1:

Sequence; same for both SEQRES and ATOM records:

>d6cqna1 d.19.1.0 (A:4-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

Timeline for d6cqna1:

• d6cqna1 is new in SCOPe 2.07-stable
  
• d6cqna1 appears in the current release, SCOPe 2.08