Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.20: 3-hydroxyanthranilic acid dioxygenase-like [141618] (2 proteins) Pfam PF06052; 3-HAO |
Protein automated matches [311561] (3 species) not a true protein |
Species Ralstonia metallidurans [TaxId:266264] [311562] (4 PDB entries) |
Domain d6d60a_: 6d60 A: [353179] automated match to d4wzca_ complexed with fe2, trs |
PDB Entry: 6d60 (more details), 2.22 Å
SCOPe Domain Sequences for d6d60a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d60a_ b.82.1.20 (A:) automated matches {Ralstonia metallidurans [TaxId: 266264]} mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg fewycdacghlvhrvevqlkspvtdlpplfesfyasedkrrcphcgqvhpgraa
Timeline for d6d60a_: