Lineage for d6cqne1 (6cqn E:2-131)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1180 PDB entries)
  8. 3053115Domain d6cqne1: 6cqn E:2-131 [353177]
    Other proteins in same PDB: d6cqna1, d6cqna2, d6cqnb1, d6cqnb2, d6cqnd2
    automated match to d1tcrb1
    complexed with cl, mg, nag, so4

Details for d6cqne1

PDB Entry: 6cqn (more details), 2.5 Å

PDB Description: crystal structure of f5 tcr -dr11-rq13 peptide complex
PDB Compounds: (E:) F5 beta chain

SCOPe Domain Sequences for d6cqne1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cqne1 b.1.1.0 (E:2-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pevtqtpshqvtqmgqevilrcvpisnhlyfywyrqilgqkveflvsfynneisekseif
ddqfsverpdgsnftlkirstkledsamyfcassglaggmdeqffgpgtrltvle

SCOPe Domain Coordinates for d6cqne1:

Click to download the PDB-style file with coordinates for d6cqne1.
(The format of our PDB-style files is described here.)

Timeline for d6cqne1:

  • d6cqne1 appears in periodic updates to SCOPe 2.07 starting on 2018-06-06