SCOPe 2.08: Domain d5o1rm1: 5o1r M:1-105

Lineage for d5o1rm1 (5o1r M:1-105)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5o1rm1: 5o1r M:1-105 [353132]
   Other proteins in same PDB: d5o1rl2, d5o1rm2
   automated match to d1dn0a1
   complexed with edo

Details for d5o1rm1

PDB Entry: 5o1r, 2.86 Å

PDB Description: human fab 5h2 bound to nhba-c3 from neisseria meningitidis serogroup b

PDB Compounds: (M:) Uncharacterized protein

SCOPe Domain Sequences for d5o1rm1:

Sequence; same for both SEQRES and ATOM records:

>d5o1rm1 b.1.1.0 (M:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltyaasslgsgvps
rfsgsgsgtdltltisslrpedfatyycqqsygsptfgqgtklei

Timeline for d5o1rm1:

• d5o1rm1 first appeared in SCOPe 2.07