Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily) alpha1-beta3; 2 layers: alpha/beta; order 132 |
Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (2 families) duplication: consists of 2 subdomains of this fold |
Family d.11.1.0: automated matches [352956] (1 protein) not a true family |
Protein automated matches [352957] (2 species) not a true protein |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [353009] (2 PDB entries) |
Domain d5oj0a4: 5oj0 A:693-750 [353011] Other proteins in same PDB: d5oj0a1, d5oj0a2 automated match to d1k25a2 complexed with 9wt |
PDB Entry: 5oj0 (more details), 2.66 Å
SCOPe Domain Sequences for d5oj0a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oj0a4 d.11.1.0 (A:693-750) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} aeevpdmygwtketaetlakwlnielefqgsgstvqkqdvrantaikdikkitltlgd
Timeline for d5oj0a4: