Lineage for d5oj0a4 (5oj0 A:693-750)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929489Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
    alpha1-beta3; 2 layers: alpha/beta; order 132
  4. 2929490Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (2 families) (S)
    duplication: consists of 2 subdomains of this fold
  5. 2929530Family d.11.1.0: automated matches [352956] (1 protein)
    not a true family
  6. 2929531Protein automated matches [352957] (2 species)
    not a true protein
  7. 2929532Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [353009] (2 PDB entries)
  8. 2929536Domain d5oj0a4: 5oj0 A:693-750 [353011]
    Other proteins in same PDB: d5oj0a1, d5oj0a2
    automated match to d1k25a2
    complexed with 9wt

Details for d5oj0a4

PDB Entry: 5oj0 (more details), 2.66 Å

PDB Description: penicillin-binding protein 2x (pbp2x) from streptococcus pneumoniae in complex with cefepime
PDB Compounds: (A:) penicillin-binding protein 2x

SCOPe Domain Sequences for d5oj0a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oj0a4 d.11.1.0 (A:693-750) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
aeevpdmygwtketaetlakwlnielefqgsgstvqkqdvrantaikdikkitltlgd

SCOPe Domain Coordinates for d5oj0a4:

Click to download the PDB-style file with coordinates for d5oj0a4.
(The format of our PDB-style files is described here.)

Timeline for d5oj0a4: