Lineage for d1f2dd_ (1f2d D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1874686Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1874687Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1874688Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1874689Protein 1-aminocyclopropane-1-carboxylate deaminase [53694] (3 species)
  7. 1874743Species Yeast (Hansenula saturnus) [TaxId:4906] [53695] (4 PDB entries)
  8. 1874747Domain d1f2dd_: 1f2d D: [35301]
    complexed with plp, so4

Details for d1f2dd_

PDB Entry: 1f2d (more details), 2 Å

PDB Description: 1-aminocyclopropane-1-carboxylate deaminase
PDB Compounds: (D:) 1-aminocyclopropane-1-carboxylate deaminase

SCOPe Domain Sequences for d1f2dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2dd_ c.79.1.1 (D:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]}
agvakfakypltfgpspisnlnrlsqhlgskvnvyakredcnsglafggnklrkleyivp
divegdythlvsiggrqsnqtrmvaalaaklgkkcvliqedwvpipeaekdvynrvgnie
lsrimgadvrviedgfdigmrksfanalqeledaghkpypipagcsehkygglgfvgfad
evinqevelgikfdkivvccvtgsttagilagmaqygrqddviaidasftsektkeqtlr
ianntakligvehefkdftldtrfaypcygvpnegtieairtcaeqegvltdpvyegksm
qglialikedyfkpganvlyvhlggapalsayssffptkta

SCOPe Domain Coordinates for d1f2dd_:

Click to download the PDB-style file with coordinates for d1f2dd_.
(The format of our PDB-style files is described here.)

Timeline for d1f2dd_: