Lineage for d1tdja1 (1tdj A:5-335)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907556Protein Threonine deaminase [53692] (2 species)
  7. 2907557Species Escherichia coli [TaxId:562] [53693] (1 PDB entry)
  8. 2907558Domain d1tdja1: 1tdj A:5-335 [35297]
    Other proteins in same PDB: d1tdja2, d1tdja3
    CASP2
    complexed with plp

Details for d1tdja1

PDB Entry: 1tdj (more details), 2.8 Å

PDB Description: threonine deaminase (biosynthetic) from e. coli
PDB Compounds: (A:) biosynthetic threonine deaminase

SCOPe Domain Sequences for d1tdja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]}
qplsgapegaeylravlrapvyeaaqvtplqkmeklssrldnvilvkredrqpvhsfklr
gayammaglteeqkahgvitasagnhaqgvafssarlgvkalivmptatadikvdavrgf
ggevllhganfdeakakaielsqqqgftwvppfdhpmviagqgtlalellqqdahldrvf
vpvgggglaagvavlikqlmpqikviaveaedsaclkaaldaghpvdlprvglfaegvav
krigdetfrlcqeylddiitvdsdaicaamkdlfedvravaepsgalalagmkkyialhn
irgerlahilsganvnfhglryvsercelge

SCOPe Domain Coordinates for d1tdja1:

Click to download the PDB-style file with coordinates for d1tdja1.
(The format of our PDB-style files is described here.)

Timeline for d1tdja1: