Class a: All alpha proteins [46456] (290 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein Ethr repressor [109978] (2 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries) Uniprot P96222 22-215 |
Domain d5nz1h2: 5nz1 H:100-215 [352962] Other proteins in same PDB: d5nz1a1, d5nz1b1, d5nz1c1, d5nz1d1, d5nz1e1, d5nz1f1, d5nz1g1, d5nz1h1 automated match to d5nima2 complexed with 9en |
PDB Entry: 5nz1 (more details), 2.33 Å
SCOPe Domain Sequences for d5nz1h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nz1h2 a.121.1.1 (H:100-215) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]} enmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavidaerdr gaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiygen
Timeline for d5nz1h2: