SCOPe 2.08: Domain d5nz1h1: 5nz1 H:23-93

Lineage for d5nz1h1 (5nz1 H:23-93)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Ethr repressor [109651] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109652] (34 PDB entries)
   Uniprot P96222 22-215

8. Domain d5nz1h1: 5nz1 H:23-93 [352961]
   Other proteins in same PDB: d5nz1a2, d5nz1b2, d5nz1c2, d5nz1d2, d5nz1e2, d5nz1f2, d5nz1g2, d5nz1h2
   automated match to d5nima1
   complexed with 9en

Details for d5nz1h1

PDB Entry: 5nz1, 2.33 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with sutezolid

PDB Compounds: (H:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5nz1h1:

Sequence, based on SEQRES records:

>d5nz1h1 a.4.1.9 (H:23-93) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
ddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvnq
admalqtlaen

Sequence, based on observed residues (ATOM records):

>d5nz1h1 a.4.1.9 (H:23-93) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
ddrelailataenlledrpladisvddptfyfyfpskeavlltlldrvvnqadmalqtla
en

Timeline for d5nz1h1:

• d5nz1h1 first appeared in SCOPe 2.07