SCOPe 2.08: Domain d1oasa_: 1oas A:

Lineage for d1oasa_ (1oas A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)

7. Species Salmonella typhimurium [TaxId:90371] [53691] (3 PDB entries)

8. Domain d1oasa_: 1oas A: [35293]
   complexed with plp

Details for d1oasa_

PDB Entry: 1oas, 2.2 Å

PDB Description: o-acetylserine sulfhydrylase from salmonella typhimurium

PDB Compounds: (A:) O-acetylserine sulfhydrylase

SCOPe Domain Sequences for d1oasa_:

Sequence; same for both SEQRES and ATOM records:

>d1oasa_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]}
skiyednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
sgerylstalfadlf

Timeline for d1oasa_:

• d1oasa_ first appeared (with stable ids) in SCOP 1.55
  
• d1oasa_ appears in SCOPe 2.07