Lineage for d6ci9l1 (6ci9 L:1-252)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847722Species Mycobacterium smegmatis [TaxId:246196] [189539] (12 PDB entries)
  8. 2847752Domain d6ci9l1: 6ci9 L:1-252 [352923]
    Other proteins in same PDB: d6ci9a2, d6ci9b2, d6ci9c2, d6ci9d2, d6ci9e2, d6ci9f2, d6ci9g2, d6ci9h2, d6ci9i2, d6ci9j2, d6ci9k2, d6ci9l2, d6ci9m2, d6ci9n2, d6ci9p2
    automated match to d3riha_
    complexed with cl, f3v, mg, nap

Details for d6ci9l1

PDB Entry: 6ci9 (more details), 1.9 Å

PDB Description: rmm microcompartment-associated aminopropanol dehydrogenase nadp + aminoacetone holo-structure
PDB Compounds: (L:) 3-oxoacyl-[acyl-carrier-protein] reductase

SCOPe Domain Sequences for d6ci9l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ci9l1 c.2.1.0 (L:1-252) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mftslegrsaivtggskgigrgiaetfanagvdvvitgrnqddldrtvadlsgtrgkvta
vradvtdpedarrtvaetvsrhggldivcanagifpsgrledltpddieqvlgvnfkgtv
yivqaalqaltasghgrvvvtssitgpitgypgwshygaskaaqlgflrtaamelapkki
tinavlpgnimtegldemgqdyldqmasaipagrlgsvadignaalffatdeaayvtgqt
lvvdggqvlpes

SCOPe Domain Coordinates for d6ci9l1:

Click to download the PDB-style file with coordinates for d6ci9l1.
(The format of our PDB-style files is described here.)

Timeline for d6ci9l1: