Lineage for d6cvmc4 (6cvm C:626-730)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2359630Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2360089Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2360090Protein automated matches [254633] (14 species)
    not a true protein
  7. 2360314Species Escherichia coli [TaxId:83333] [272134] (10 PDB entries)
  8. 3052844Domain d6cvmc4: 6cvm C:626-730 [352906]
    Other proteins in same PDB: d6cvma1, d6cvma3, d6cvma5, d6cvmb1, d6cvmb3, d6cvmb5, d6cvmc1, d6cvmc3, d6cvmc5, d6cvmd1, d6cvmd3, d6cvmd5
    automated match to d1jz8a2
    complexed with mg, na, ptq

Details for d6cvmc4

PDB Entry: 6cvm (more details), 1.9 Å

PDB Description: atomic resolution cryo-em structure of beta-galactosidase
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d6cvmc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cvmc4 b.1.4.0 (C:626-730) automated matches {Escherichia coli [TaxId: 83333]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d6cvmc4:

Click to download the PDB-style file with coordinates for d6cvmc4.
(The format of our PDB-style files is described here.)

Timeline for d6cvmc4: