Lineage for d6cvmc3 (6cvm C:334-625)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (109 species)
    not a true protein
  7. 2419065Species Escherichia coli [TaxId:83333] [272137] (10 PDB entries)
  8. 3052843Domain d6cvmc3: 6cvm C:334-625 [352905]
    Other proteins in same PDB: d6cvma1, d6cvma2, d6cvma4, d6cvma5, d6cvmb1, d6cvmb2, d6cvmb4, d6cvmb5, d6cvmc1, d6cvmc2, d6cvmc4, d6cvmc5, d6cvmd1, d6cvmd2, d6cvmd4, d6cvmd5
    automated match to d1jz7a5
    complexed with mg, na, ptq

Details for d6cvmc3

PDB Entry: 6cvm (more details), 1.9 Å

PDB Description: atomic resolution cryo-em structure of beta-galactosidase
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d6cvmc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cvmc3 c.1.8.0 (C:334-625) automated matches {Escherichia coli [TaxId: 83333]}
vvriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d6cvmc3:

Click to download the PDB-style file with coordinates for d6cvmc3.
(The format of our PDB-style files is described here.)

Timeline for d6cvmc3: