Lineage for d6c97a1 (6c97 A:4-176)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (76 PDB entries)
  8. 3052827Domain d6c97a1: 6c97 A:4-176 [352889]
    Other proteins in same PDB: d6c97a2, d6c97b_, d6c97c2, d6c97d_
    automated match to d3frua2
    complexed with gol

Details for d6c97a1

PDB Entry: 6c97 (more details), 2 Å

PDB Description: crystal structure of fcrn at ph3
PDB Compounds: (A:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d6c97a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c97a1 d.19.1.0 (A:4-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswywek
ettdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlk
qgtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew

SCOPe Domain Coordinates for d6c97a1:

Click to download the PDB-style file with coordinates for d6c97a1.
(The format of our PDB-style files is described here.)

Timeline for d6c97a1:

  • d6c97a1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-31