Lineage for d6d8bc_ (6d8b C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776533Species Influenza A virus [TaxId:1332244] [228093] (27 PDB entries)
  8. 2776590Domain d6d8bc_: 6d8b C: [352833]
    Other proteins in same PDB: d6d8bb_, d6d8bd_, d6d8bf_
    automated match to d4n62a_
    complexed with nag

Details for d6d8bc_

PDB Entry: 6d8b (more details), 2.95 Å

PDB Description: the crystal structure of hemagglutinin from a/hong kong/125/2017 h7n9 influenza virus
PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6d8bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d8bc_ b.19.1.0 (C:) automated matches {Influenza A virus [TaxId: 1332244]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftyngi
rtngvtsackrsgssfyaemkwllsntdnaafpqmtksykntrkspaiivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlilnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpe

SCOPe Domain Coordinates for d6d8bc_:

Click to download the PDB-style file with coordinates for d6d8bc_.
(The format of our PDB-style files is described here.)

Timeline for d6d8bc_: