Lineage for d6d7ua_ (6d7u A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385678Protein automated matches [190291] (21 species)
    not a true protein
  7. 2385807Species Influenza A virus, different strains [TaxId:11320] [187142] (20 PDB entries)
  8. 2385850Domain d6d7ua_: 6d7u A: [352823]
    Other proteins in same PDB: d6d7ub_, d6d7ud_, d6d7uf_
    automated match to d4dj6a_
    complexed with nag

Details for d6d7ua_

PDB Entry: 6d7u (more details), 2.7 Å

PDB Description: the crystal structure of hemagglutinin from a/guangdong/17sf003/2016 h7n9 influenza virus
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6d7ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d7ua_ b.19.1.2 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dkiclghhavsngtkvntltergvevvnatetvertntpricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkepmgftyngi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrespaiivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfng
afiapdrasflrgksmgiqsrvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpe

SCOPe Domain Coordinates for d6d7ua_:

Click to download the PDB-style file with coordinates for d6d7ua_.
(The format of our PDB-style files is described here.)

Timeline for d6d7ua_: