Lineage for d6dgia2 (6dgi A:116-332)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541793Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2541794Protein automated matches [226904] (37 species)
    not a true protein
  7. 3052749Species Vibrio cholerae [TaxId:243277] [352811] (1 PDB entry)
  8. 3052750Domain d6dgia2: 6dgi A:116-332 [352812]
    Other proteins in same PDB: d6dgia1, d6dgia3, d6dgib1
    automated match to d5d8da2
    complexed with act, gol, mg

Details for d6dgia2

PDB Entry: 6dgi (more details), 2.3 Å

PDB Description: the crystal structure of d-alanyl-alanine synthetase a from vibrio cholerae o1 biovar eltor str. n16961
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d6dgia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dgia2 d.142.1.0 (A:116-332) automated matches {Vibrio cholerae [TaxId: 243277]}
nkitsklwydaldipntpylfltqntpssidkakqafghwgsifvkaarqgssvgcykvt
tedqiapaieaafgfseqvlveqavkprelevsayemngklyiskpgeviapegtfysye
ekysanshartvleaenltekhkeliqtyaervfihmklrhlsridffltqegqiylnev
ntfpgmtpismfpkmlehnghrfseflvqcvtntlvn

SCOPe Domain Coordinates for d6dgia2:

Click to download the PDB-style file with coordinates for d6dgia2.
(The format of our PDB-style files is described here.)

Timeline for d6dgia2:

  • d6dgia2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-31