Lineage for d6ek2h2 (6ek2 H:339-445)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761049Domain d6ek2h2: 6ek2 H:339-445 [352808]
    Other proteins in same PDB: d6ek2a1, d6ek2a2, d6ek2b_
    automated match to d2ghwb1

Details for d6ek2h2

PDB Entry: 6ek2 (more details), 2.65 Å

PDB Description: crystal structure of human cd81 large extracellular loop in complex with single chain fv fragment 10
PDB Compounds: (H:) single chain fv fragment

SCOPe Domain Sequences for d6ek2h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ek2h2 b.1.1.0 (H:339-445) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqssssfsvslgdrvtitckasediynrlawyqqkpgnaprllisgatsletgvps
rfsgsgsgkdytlsitslqtedfatyycqqywsppwtfgggtkleik

SCOPe Domain Coordinates for d6ek2h2:

Click to download the PDB-style file with coordinates for d6ek2h2.
(The format of our PDB-style files is described here.)

Timeline for d6ek2h2: