SCOPe 2.08: Domain d6degb1: 6deg B:1-119

Lineage for d6degb1 (6deg B:1-119)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Bartonella birtlesii [TaxId:1094552] [352802] (1 PDB entry)

8. Domain d6degb1: 6deg B:1-119 [352803]
   Other proteins in same PDB: d6dega4, d6degb4
   automated match to d6amsa1

Details for d6degb1

PDB Entry: 6deg, 2.45 Å

PDB Description: crystal structure of a dna polymerase iii subunit beta dnan sliding clamp from bartonella birtlesii ll-wm9

PDB Compounds: (B:) Beta sliding clamp

SCOPe Domain Sequences for d6degb1:

Sequence, based on SEQRES records:

>d6degb1 d.131.1.0 (B:1-119) automated matches {Bartonella birtlesii [TaxId: 1094552]}
mritvdrsqffkslgrvhrvverrntvpilsnvlidaengsvqlkatdldlevtesftvn
iekagaitvpayllydivrklpdgseivlsvdenqasamsivsgcthfqlqclpkidfp

Sequence, based on observed residues (ATOM records):

>d6degb1 d.131.1.0 (B:1-119) automated matches {Bartonella birtlesii [TaxId: 1094552]}
mritvdrsqffkslgrvhrvverrntvpilsnvlidaengsvqlkatdldlevtesftvn
iekagaitvpayllydivrklpdgseivlsvdasamsivsgcthfqlqclpkidfp

Timeline for d6degb1:

• d6degb1 first appeared in SCOPe 2.07