SCOPe 2.08: Domain d6fh6a1: 6fh6 A:1858-1970

Lineage for d6fh6a1 (6fh6 A:1858-1970)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d6fh6a1: 6fh6 A:1858-1970 [352774]
   Other proteins in same PDB: d6fh6a2
   automated match to d3uv2a_
   complexed with d8q

Details for d6fh6a1

PDB Entry: 6fh6, 2.08 Å

PDB Description: crystal structure of baz2b bromodomain in complex with 1- methylpyridinone compound 1

PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d6fh6a1:

Sequence; same for both SEQRES and ATOM records:

>d6fh6a1 a.29.2.0 (A:1858-1970) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstirek
lssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk

Timeline for d6fh6a1:

• d6fh6a1 first appeared in SCOPe 2.07