SCOP 1.55: Domain d1a5ab_: 1a5a B:

Lineage for d1a5ab_ (1a5a B:)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (4 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (21 PDB entries)

8. Domain d1a5ab_: 1a5a B: [35276]
   Other proteins in same PDB: d1a5aa_

Details for d1a5ab_

PDB Entry: 1a5a, 1.9 Å

PDB Description: cryo-crystallography of a true substrate, indole-3-glycerol phosphate, bound to a mutant (alphad60n) tryptophan synthase alpha2beta2 complex reveals the correct orientation of active site alpha glu 49

SCOP Domain Sequences for d1a5ab_:

Sequence; same for both SEQRES and ATOM records:

>d1a5ab_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdil

Timeline for d1a5ab_:

• d1a5ab_ appears in SCOP 1.57
  
• d1a5ab_ appears in the current release, SCOPe 2.08