Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
Domain d6c98a1: 6c98 A:4-176 [352754] Other proteins in same PDB: d6c98a2, d6c98b_, d6c98c2, d6c98d_ automated match to d3frua2 complexed with cys, er7, gol, peg |
PDB Entry: 6c98 (more details), 1.85 Å
SCOPe Domain Sequences for d6c98a1:
Sequence, based on SEQRES records: (download)
>d6c98a1 d.19.1.0 (A:4-176) automated matches {Human (Homo sapiens) [TaxId: 9606]} hlsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswywek ettdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlk qgtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew
>d6c98a1 d.19.1.0 (A:4-176) automated matches {Human (Homo sapiens) [TaxId: 9606]} hlsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswywek ettdlrikeklfleafkalggpytlqgllgcelgpdntsvptakfalngeefmnfdlkqg twggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew
Timeline for d6c98a1:
View in 3D Domains from other chains: (mouse over for more information) d6c98b_, d6c98c1, d6c98c2, d6c98d_ |