Lineage for d6f1na_ (6f1n A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537078Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2537079Protein HSP90 [55876] (3 species)
  7. 2537164Species Human (Homo sapiens) [TaxId:9606] [55878] (144 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 3052686Domain d6f1na_: 6f1n A: [352748]
    automated match to d1uy7a_
    complexed with c8w, so4

Details for d6f1na_

PDB Entry: 6f1n (more details), 2.09 Å

PDB Description: estimation of relative drug-target residence times by random acceleration molecular dynamics simulation
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d6f1na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f1na_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
eevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgk
elhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqf
gvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedq
teyleerrikeivkkhsqfigypitlfve

SCOPe Domain Coordinates for d6f1na_:

Click to download the PDB-style file with coordinates for d6f1na_.
(The format of our PDB-style files is described here.)

Timeline for d6f1na_:

  • d6f1na_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-31