Lineage for d1b74a2 (1b74 A:106-252)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.78: ATC-like [53670] (2 superfamilies) 
Superfamily c.78.2: Glutamate racemase [53681] (1 family) 
Family c.78.2.1: Glutamate racemase [53682] (1 protein) Protein Glutamate racemase [53683] (1 species) Species Aquifex pyrophilus [TaxId:2714] [53684] (2 PDB entries) 
Domain d1b74a2: 1b74 A:106-252 [35265]
Details for d1b74a2
PDB Entry: 1b74 (more details), 2.3 Å
PDB Description: glutamate racemase from aquifex pyrophilus
SCOP Domain Sequences for d1b74a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b74a2 c.78.2.1 (A:106-252) Glutamate racemase {Aquifex pyrophilus}
nkkigvigtpatvksgayqrkleeggadvfakacplfaplaeegllegeitrkvvehylk
efkgkidtlilgcthypllkkeikkflgdaevvdssealslslhnfikddgssslelfft
dlspnlqfliklilgrdypvklaegvf
SCOP Domain Coordinates for d1b74a2:
Click to download the PDB-style file with coordinates for d1b74a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b74a2:
- d1b74a2 appears in SCOP 1.57
- d1b74a2 appears in the current release, SCOPe 2.08
View in 3D
