Lineage for d5ylya2 (5yly A:721-863)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859901Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2859902Protein automated matches [226871] (19 species)
    not a true protein
  7. 2860036Species Ulva prolifera [TaxId:3117] [352647] (1 PDB entry)
  8. 2860037Domain d5ylya2: 5yly A:721-863 [352648]
    Other proteins in same PDB: d5ylya1, d5ylyb1
    automated match to d1umka2
    complexed with fad

Details for d5ylya2

PDB Entry: 5yly (more details), 1.76 Å

PDB Description: crystal structure of the cytochrome b5 reductase domain of ulva prolifera nitrate reductase
PDB Compounds: (A:) nitrate reductase

SCOPe Domain Sequences for d5ylya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ylya2 c.25.1.0 (A:721-863) automated matches {Ulva prolifera [TaxId: 3117]}
pghyknhklesevkrinmiaggtgltpmyqvmkailsnpsdlteirllyanqteadillr
pelealakshpdrvkihytvdrptpgwkyssgfidldmceralfryepgtisvlcgpppm
lkfachpnlekmgfekgvtsief

SCOPe Domain Coordinates for d5ylya2:

Click to download the PDB-style file with coordinates for d5ylya2.
(The format of our PDB-style files is described here.)

Timeline for d5ylya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ylya1