Lineage for d5yisb_ (5yis B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502275Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2502297Protein automated matches [190358] (6 species)
    not a true protein
  7. 3052518Species Mus musculus [TaxId:10090] [352580] (3 PDB entries)
  8. 3052563Domain d5yisb_: 5yis B: [352625]
    automated match to d2zjdc_
    complexed with gol, po4

Details for d5yisb_

PDB Entry: 5yis (more details), 2.2 Å

PDB Description: crystal structure of ankb lir/lc3b complex
PDB Compounds: (B:) Microtubule-associated proteins 1A/1B light chain 3B

SCOPe Domain Sequences for d5yisb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yisb_ d.15.1.3 (B:) automated matches {Mus musculus [TaxId: 10090]}
ektfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmsel
ikiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqetfgtam
av

SCOPe Domain Coordinates for d5yisb_:

Click to download the PDB-style file with coordinates for d5yisb_.
(The format of our PDB-style files is described here.)

Timeline for d5yisb_:

  • d5yisb_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-24