Lineage for d5og2a1 (5og2 A:8-166)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367152Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2367387Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2367388Species Achromobacter cycloclastes [TaxId:223] [49552] (54 PDB entries)
  8. 3052523Domain d5og2a1: 5og2 A:8-166 [352585]
    automated match to d5i6la1
    complexed with act, cu, no2

Details for d5og2a1

PDB Entry: 5og2 (more details), 1.64 Å

PDB Description: cu nitrite reductase serial data at varying temperatures rt 0.09mgy
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5og2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5og2a1 b.6.1.3 (A:8-166) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

SCOPe Domain Coordinates for d5og2a1:

Click to download the PDB-style file with coordinates for d5og2a1.
(The format of our PDB-style files is described here.)

Timeline for d5og2a1:

  • d5og2a1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-24

View in 3D
Domains from same chain:
(mouse over for more information)
d5og2a2