Lineage for d5yipa1 (5yip A:1-117)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502275Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2502297Protein automated matches [190358] (6 species)
    not a true protein
  7. 3052518Species Mus musculus [TaxId:10090] [352580] (3 PDB entries)
  8. 3052519Domain d5yipa1: 5yip A:1-117 [352581]
    Other proteins in same PDB: d5yipa2
    automated match to d1gnua_
    complexed with gol

Details for d5yipa1

PDB Entry: 5yip (more details), 1.85 Å

PDB Description: crystal structure of ankg lir/gabarapl1 complex
PDB Compounds: (A:) Gamma-aminobutyric acid receptor-associated protein-like 1

SCOPe Domain Sequences for d5yipa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yipa1 d.15.1.3 (A:1-117) automated matches {Mus musculus [TaxId: 10090]}
mkfqykedhpfeyrkkegekirkkypdrvpvivekapkarvpdldkrkylvpsdltvgqf
yflirkrihlrpedalfffvnntipptsatmgqlyednheedyflyvaysdesvygk

SCOPe Domain Coordinates for d5yipa1:

Click to download the PDB-style file with coordinates for d5yipa1.
(The format of our PDB-style files is described here.)

Timeline for d5yipa1:

  • d5yipa1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-24