Lineage for d5mgsd_ (5mgs D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (17 species)
    not a true protein
  7. 2559734Species Human (Homo sapiens) [TaxId:9606] [186882] (84 PDB entries)
  8. 3052470Domain d5mgsd_: 5mgs D: [352532]
    automated match to d1xpha_
    complexed with nag

Details for d5mgsd_

PDB Entry: 5mgs (more details), 1.9 Å

PDB Description: human receptor nkr-p1 in deglycosylated form, extracellular domain
PDB Compounds: (D:) Killer cell lectin-like receptor subfamily B member 1

SCOPe Domain Sequences for d5mgsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mgsd_ d.169.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gllncpiywqqlrekcllfshtvnpwnnsladcstkesslllirdkdelihtqnlirdka
ilfwiglnfslseknwkwingsflnsndleirgdakenscisisqtsvyseycsteirwi
cqkel

SCOPe Domain Coordinates for d5mgsd_:

Click to download the PDB-style file with coordinates for d5mgsd_.
(The format of our PDB-style files is described here.)

Timeline for d5mgsd_:

  • d5mgsd_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-24