Lineage for d5mv1a2 (5mv1 A:300-401)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362784Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2362785Protein automated matches [190226] (62 species)
    not a true protein
  7. 3052447Species Japanese encephalitis virus (strain sa-14) [TaxId:11073] [352509] (2 PDB entries)
  8. 3052458Domain d5mv1a2: 5mv1 A:300-401 [352520]
    Other proteins in same PDB: d5mv1a1, d5mv1a3
    automated match to d3p54a2

Details for d5mv1a2

PDB Entry: 5mv1 (more details), 2.25 Å

PDB Description: crystal structure of the e protein of the japanese encephalitis virulent virus
PDB Compounds: (A:) E protein

SCOPe Domain Sequences for d5mv1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mv1a2 b.1.18.0 (A:300-401) automated matches {Japanese encephalitis virus (strain sa-14) [TaxId: 11073]}
tygmctekfsfaknpadtghgtvvielsysgsdgsckipivsvaslndmtpvgrlvtvnp
fvatssanskvlvemeppfgdsyivvgrgdkqinhhwhkags

SCOPe Domain Coordinates for d5mv1a2:

Click to download the PDB-style file with coordinates for d5mv1a2.
(The format of our PDB-style files is described here.)

Timeline for d5mv1a2:

  • d5mv1a2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-24