SCOPe 2.08: Domain d5mv1a1: 5mv1 A:1-299

Lineage for d5mv1a1 (5mv1 A:1-299)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
   2 intertwined domains; all-beta and alpha+beta

4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families)

5. Family f.10.1.0: automated matches [227258] (1 protein)
   not a true family

6. Protein automated matches [227047] (11 species)
   not a true protein

7. Species Japanese encephalitis virus (strain sa-14) [TaxId:11073] [352507] (2 PDB entries)

8. Domain d5mv1a1: 5mv1 A:1-299 [352519]
   Other proteins in same PDB: d5mv1a2, d5mv1a3
   automated match to d3p54a1

Details for d5mv1a1

PDB Entry: 5mv1, 2.25 Å

PDB Description: crystal structure of the e protein of the japanese encephalitis virulent virus

PDB Compounds: (A:) E protein

SCOPe Domain Sequences for d5mv1a1:

Sequence; same for both SEQRES and ATOM records:

>d5mv1a1 f.10.1.0 (A:1-299) automated matches {Japanese encephalitis virus (strain sa-14) [TaxId: 11073]}
fnclgmgnrdfiegasgatwvdlvlegdscltimandkptldvrminieasqlaevrsyc
yhasvtdistvarcpttgeahnekradssyvckqgftdrgwgngcglfgkgsidtcakfs
ctskaigrtiqpenikyevgifvhgtttsenhgnysaqvgasqaakftvtpnapsitlkl
gdygevtldceprsglnteafyvmtvgsksflvhrewfhdlalpwtspsstawrnrellm
efegahatkqsvvalgsqegglhqalagaivveysssvkltsghlkcrlkmdklalkgt

Timeline for d5mv1a1:

• d5mv1a1 first appeared in SCOPe 2.07