Lineage for d6c9ul2 (6c9u L:130-231)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756305Domain d6c9ul2: 6c9u L:130-231 [352518]
    automated match to d1um5l2
    complexed with k, na

Details for d6c9ul2

PDB Entry: 6c9u (more details), 2.09 Å

PDB Description: crystal structure of [ks3][at3] didomain from module 3 of 6- deoxyerthronolide b synthase in complex with antibody fragment (fab)
PDB Compounds: (L:) Light chain of Fab 1B2

SCOPe Domain Sequences for d6c9ul2:

Sequence, based on SEQRES records: (download)

>d6c9ul2 b.1.1.0 (L:130-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfyprgakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksf

Sequence, based on observed residues (ATOM records): (download)

>d6c9ul2 b.1.1.0 (L:130-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfyprgakvqwkvqsgnsqesvteqdskds
tyslsstltlskadyekhkacevthqglsspvtksf

SCOPe Domain Coordinates for d6c9ul2:

Click to download the PDB-style file with coordinates for d6c9ul2.
(The format of our PDB-style files is described here.)

Timeline for d6c9ul2: