Lineage for d5mv2a1 (5mv2 A:1-299)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576583Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2576584Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2576629Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 2576630Protein automated matches [227047] (10 species)
    not a true protein
  7. 3052445Species Japanese encephalitis virus (strain sa-14) [TaxId:11073] [352507] (2 PDB entries)
  8. 3052446Domain d5mv2a1: 5mv2 A:1-299 [352508]
    Other proteins in same PDB: d5mv2a2, d5mv2a3
    automated match to d3p54a1

Details for d5mv2a1

PDB Entry: 5mv2 (more details), 2.1 Å

PDB Description: crystal structure of the e protein of the japanese encephalitis live attenuated vaccine virus
PDB Compounds: (A:) E protein

SCOPe Domain Sequences for d5mv2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mv2a1 f.10.1.0 (A:1-299) automated matches {Japanese encephalitis virus (strain sa-14) [TaxId: 11073]}
fnclgmgnrdfiegasgatwvdlvlegdscltimandkptldvrminieasqlaevrsyc
yhasvtdistvarcpttgeahnekradssyvckqgftdrgwgngcgffgkgsidtcakfs
ctskaigrtiqpenikykvgifvhgtttsenhgnysaqvgasqaakftvtpnapsvalkl
gdygevtldceprsglnteafyvmtvgsksflvhrewfhdlalpwtspsstawrnrellm
efegahatkqsvvalgsqegglhhalagaivveysssvmltsghlkcrlkmdklalkgt

SCOPe Domain Coordinates for d5mv2a1:

Click to download the PDB-style file with coordinates for d5mv2a1.
(The format of our PDB-style files is described here.)

Timeline for d5mv2a1:

  • d5mv2a1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-24