Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267816] (20 PDB entries) |
Domain d6czyc1: 6czy C:72-430 [352487] Other proteins in same PDB: d6czya2, d6czyb2, d6czyc2, d6czyd2 automated match to d3m5ua_ complexed with mpd, na, peg, pmp, so4 |
PDB Entry: 6czy (more details), 1.75 Å
SCOPe Domain Sequences for d6czyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6czyc1 c.67.1.0 (C:72-430) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrqlle ipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnviwsg ksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcskpv dvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntppcf giymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnvpft lekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqakha
Timeline for d6czyc1: