Lineage for d6d57a_ (6d57 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (78 species)
    not a true protein
  7. 2307216Species Campylobacter jejuni [TaxId:32022] [195104] (2 PDB entries)
  8. 3052423Domain d6d57a_: 6d57 A: [352485]
    Other proteins in same PDB: d6d57b2
    automated match to d4etsa_
    complexed with fmt, gol, zn

Details for d6d57a_

PDB Entry: 6d57 (more details), 1.81 Å

PDB Description: campylobacter jejuni ferric uptake regulator s1 metalated
PDB Compounds: (A:) ferric uptake regulation protein

SCOPe Domain Sequences for d6d57a_:

Sequence, based on SEQRES records: (download)

>d6d57a_ a.4.5.0 (A:) automated matches {Campylobacter jejuni [TaxId: 32022]}
ienveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqaepdlnv
giatvyrtlnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefenpiierq
qaliakehgfkltghlmqlygvcgdcn

Sequence, based on observed residues (ATOM records): (download)

>d6d57a_ a.4.5.0 (A:) automated matches {Campylobacter jejuni [TaxId: 32022]}
ienveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqaepdnvg
iatvyrtlnlleeaemvtsisfggkkyelankphhdhmickncgkiiefenpiierqqal
iakehgfkltghlmqlygvcgdcn

SCOPe Domain Coordinates for d6d57a_:

Click to download the PDB-style file with coordinates for d6d57a_.
(The format of our PDB-style files is described here.)

Timeline for d6d57a_:

  • d6d57a_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-24