SCOPe 2.08: Domain d6d57a_: 6d57 A:

Lineage for d6d57a_ (6d57 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:32022] [195104] (2 PDB entries)

8. Domain d6d57a_: 6d57 A: [352485]
   Other proteins in same PDB: d6d57b2
   automated match to d4etsa_
   complexed with fmt, gol, zn

Details for d6d57a_

PDB Entry: 6d57, 1.81 Å

PDB Description: campylobacter jejuni ferric uptake regulator s1 metalated

PDB Compounds: (A:) ferric uptake regulation protein

SCOPe Domain Sequences for d6d57a_:

Sequence, based on SEQRES records:

>d6d57a_ a.4.5.0 (A:) automated matches {Campylobacter jejuni [TaxId: 32022]}
ienveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqaepdlnv
giatvyrtlnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefenpiierq
qaliakehgfkltghlmqlygvcgdcn

Sequence, based on observed residues (ATOM records):

>d6d57a_ a.4.5.0 (A:) automated matches {Campylobacter jejuni [TaxId: 32022]}
ienveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqaepdnvg
iatvyrtlnlleeaemvtsisfggkkyelankphhdhmickncgkiiefenpiierqqal
iakehgfkltghlmqlygvcgdcn

Timeline for d6d57a_:

• d6d57a_ first appeared in SCOPe 2.07