Class b: All beta proteins [48724] (180 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (17 species) not a true protein |
Species Spinach (Spinacia oleracea) [TaxId:3562] [352451] (2 PDB entries) |
Domain d6fkfc1: 6fkf C:5-95 [352477] Other proteins in same PDB: d6fkfa2, d6fkfa3, d6fkfb2, d6fkfb3, d6fkfc2, d6fkfc3, d6fkfd2, d6fkfd3, d6fkfe2, d6fkfe3, d6fkff2, d6fkff3 automated match to d1maba2 complexed with adp, atp, mg |
PDB Entry: 6fkf (more details), 3.1 Å
SCOPe Domain Sequences for d6fkfc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fkfc1 b.49.1.0 (C:5-95) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]} radeiskiireriegynrevkvvntgtvlqvgdgiarihgldevmagelvefeegtigia lnlesnnvgvvlmgdglmiqegssvkatgri
Timeline for d6fkfc1: