SCOPe 2.08: Domain d6fkfd1: 6fkf D:17-97

Lineage for d6fkfd1 (6fkf D:17-97)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (17 species)
   not a true protein

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [352451] (2 PDB entries)

8. Domain d6fkfd1: 6fkf D:17-97 [352474]
   Other proteins in same PDB: d6fkfa2, d6fkfa3, d6fkfb2, d6fkfb3, d6fkfc2, d6fkfc3, d6fkfd2, d6fkfd3, d6fkfe2, d6fkfe3, d6fkff2, d6fkff3
   automated match to d2qe7d1
   complexed with adp, atp, mg

Details for d6fkfd1

PDB Entry: 6fkf, 3.1 Å

PDB Description: chloroplast f1fo conformation 1

PDB Compounds: (D:) ATP synthase subunit beta, chloroplastic

SCOPe Domain Sequences for d6fkfd1:

Sequence; same for both SEQRES and ATOM records:

>d6fkfd1 b.49.1.0 (D:17-97) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
kknlgriaqiigpvldvafppgkmpniynalivkgrdtagqpmnvtcevqqllgnnrvra
vamsatdgltrgmevidtgap

Timeline for d6fkfd1:

• d6fkfd1 first appeared in SCOPe 2.07