SCOPe 2.08: Domain d6fkfa2: 6fkf A:96-372

Lineage for d6fkfa2 (6fkf A:96-372)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [352453] (2 PDB entries)

8. Domain d6fkfa2: 6fkf A:96-372 [352454]
   Other proteins in same PDB: d6fkfa1, d6fkfa3, d6fkfb1, d6fkfb2, d6fkfb3, d6fkfc1, d6fkfc3, d6fkfd1, d6fkfd2, d6fkfd3, d6fkfe1, d6fkfe3, d6fkff1, d6fkff2, d6fkff3
   automated match to d1maba3
   complexed with adp, atp, mg

Details for d6fkfa2

PDB Entry: 6fkf, 3.1 Å

PDB Description: chloroplast f1fo conformation 1

PDB Compounds: (A:) ATP synthase subunit alpha, chloroplastic

SCOPe Domain Sequences for d6fkfa2:

Sequence; same for both SEQRES and ATOM records:

>d6fkfa2 c.37.1.0 (A:96-372) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
aqipvseaylgrvinalakpidgrgeitasesrliespapgimsrrsvyeplqtgliaid
amipvgrgqreliigdrqtgktavatdtilnqqgqnvicvyvaigqkassvaqvvtnfqe
rgameytivvaetadspatlqylapytgaalaeyfmyrerhtliiyddlskqaqayrqms
lllrrppgreaypgdvfylhsrlleraaklssllgegsmtalpivetqagdvsayiptnv
isitdgqiflsadlfnagirpainvgisvsrvgsaaq

Timeline for d6fkfa2:

• d6fkfa2 first appeared in SCOPe 2.07