Lineage for d6d57b1 (6d57 B:6-159)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (78 species)
    not a true protein
  7. 3052383Species Campylobacter jejuni [TaxId:197] [352445] (2 PDB entries)
  8. 3052384Domain d6d57b1: 6d57 B:6-159 [352446]
    Other proteins in same PDB: d6d57b2
    automated match to d4etsa_
    complexed with fmt, gol, zn

Details for d6d57b1

PDB Entry: 6d57 (more details), 1.81 Å

PDB Description: campylobacter jejuni ferric uptake regulator s1 metalated
PDB Compounds: (B:) ferric uptake regulation protein

SCOPe Domain Sequences for d6d57b1:

Sequence, based on SEQRES records: (download)

>d6d57b1 a.4.5.0 (B:6-159) automated matches {Campylobacter jejuni [TaxId: 197]}
mlienveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqaepdl
nvgiatvyrtlnlleeaemvtsisfgsagkkyelankphhdhmickncgkiiefenpiie
rqqaliakehgfkltghlmqlygvcgdcnnqkak

Sequence, based on observed residues (ATOM records): (download)

>d6d57b1 a.4.5.0 (B:6-159) automated matches {Campylobacter jejuni [TaxId: 197]}
mlienveydvllerfkkilrqgglkytkqrevllktlyhsdthytpeslymeikqaepdl
nvgiatvyrtlnlleeaemvtsiskkyelankphhdhmickncgkiiefenpiierqqal
iakehgfkltghlmqlygvcgdcnnqkak

SCOPe Domain Coordinates for d6d57b1:

Click to download the PDB-style file with coordinates for d6d57b1.
(The format of our PDB-style files is described here.)

Timeline for d6d57b1:

  • d6d57b1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-24

View in 3D
Domains from same chain:
(mouse over for more information)
d6d57b2
View in 3D
Domains from other chains:
(mouse over for more information)
d6d57a_