Lineage for d6dfua_ (6dfu A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2442472Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2442706Protein automated matches [190581] (10 species)
    not a true protein
  7. 3052377Species Haemophilus influenzae [TaxId:71421] [352439] (1 PDB entry)
  8. 3052379Domain d6dfua_: 6dfu A: [352441]
    automated match to d3n9ia_
    complexed with trp

Details for d6dfua_

PDB Entry: 6dfu (more details), 2.05 Å

PDB Description: tryptophan--trna ligase from haemophilus influenzae.
PDB Compounds: (A:) Tryptophan--tRNA ligase

SCOPe Domain Sequences for d6dfua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dfua_ c.26.1.1 (A:) automated matches {Haemophilus influenzae [TaxId: 71421]}
kpivfsgvqpsgeltignylgalrnwvkmqedyecifcvvdlhaitvrqdpvalrkatld
vlalylacgidpnkstifvqshvpehtqlswvlncytyfgemsrmtqfkdksaryaenin
vglfdypvlmaadillyqaksvpvgddqkqhleitrdianrfnalygniftipeifigka
garimslqdpekkmsksddnrnnvvtlledpksvakkikravtdsdeppvvrydvqnkag
vsnlldilsavtdkpiadlekefegkmyghlktavadevstllaslqerfhqyrndetll
dnilrqgaekarakaqetlakvyeavgfvaak

SCOPe Domain Coordinates for d6dfua_:

Click to download the PDB-style file with coordinates for d6dfua_.
(The format of our PDB-style files is described here.)

Timeline for d6dfua_:

  • d6dfua_ is new in SCOPe 2.07-stable