Lineage for d6dfub_ (6dfu B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. Protein automated matches [190581] (10 species)
    not a true protein
  7. Species Haemophilus influenzae [TaxId:71421] [352439] (1 PDB entry)
  8. Domain d6dfub_: 6dfu B: [352440]
    automated match to d3n9ia_
    complexed with trp

Details for d6dfub_

PDB Entry: 6dfu (more details), 2.05 Å

PDB Description: tryptophan--trna ligase from haemophilus influenzae.
PDB Compounds: (B:) Tryptophan--tRNA ligase

SCOPe Domain Sequences for d6dfub_:

Sequence, based on SEQRES records: (download)

>d6dfub_ c.26.1.1 (B:) automated matches {Haemophilus influenzae [TaxId: 71421]}
akpivfsgvqpsgeltignylgalrnwvkmqedyecifcvvdlhaitvrqdpvalrkatl
dvlalylacgidpnkstifvqshvpehtqlswvlncytyfgemsrmtqfkdksaryaeni
nvglfdypvlmaadillyqaksvpvgddqkqhleitrdianrfnalygniftipeifigk
agarimslqdpekkmsksddnrnnvvtlledpksvakkikravtdsdeppvvrydvqnka
gvsnlldilsavtdkpiadlekefegkmyghlktavadevstllaslqerfhqyrndetl
ldnilrqgaekarakaqetlakvyeavgfvaak

Sequence, based on observed residues (ATOM records): (download)

>d6dfub_ c.26.1.1 (B:) automated matches {Haemophilus influenzae [TaxId: 71421]}
akpivfsgvqpsgeltignylgalrnwvkmqedyecifcvvdlhaitvrqdpvalrkatl
dvlalylacgidpnkstifvqshvpehtqlswvlncytyfgemsrmtqfkdksaryaeni
nvglfdypvlmaadillyqaksvpvgddqkqhleitrdianrfnalygniftipeifigg
arimslqdpekkmsksddnrnnvvtlledpksvakkikravtdsdeppvvrydvqnkagv
snlldilsavtdkpiadlekefegkmyghlktavadevstllaslqerfhqyrndetlld
nilrqgaekarakaqetlakvyeavgfvaak

SCOPe Domain Coordinates for d6dfub_ are not available.

Timeline for d6dfub_:

Domains from other chains:
(mouse over for more information)
d6dfua_