Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (19 species) not a true protein |
Species Heteractis crispa [TaxId:175771] [188161] (2 PDB entries) |
Domain d6dejc_: 6dej C: [352431] automated match to d3svna_ complexed with 12p, cl, so4 |
PDB Entry: 6dej (more details), 1.63 Å
SCOPe Domain Sequences for d6dejc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dejc_ d.22.1.1 (C:) automated matches {Heteractis crispa [TaxId: 175771]} magllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilap ccesktfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvh gtnfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskka vraltmpgfhftdyrlqmlrkkkdeyfelyeasvarysdlpeka
Timeline for d6dejc_: