Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [53602] (24 PDB entries) |
Domain d6ddpb_: 6ddp B: [352399] automated match to d1df7a_ complexed with g6y, ndp |
PDB Entry: 6ddp (more details), 1.49 Å
SCOPe Domain Sequences for d6ddpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ddpb_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Mycobacterium tuberculosis [TaxId: 1773]} mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp reagdalapvldetwrgetgewrfsrsglryrlysyhrs
Timeline for d6ddpb_: