Lineage for d6czxb1 (6czx B:72-430)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505627Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267816] (20 PDB entries)
  8. 2505642Domain d6czxb1: 6czx B:72-430 [352389]
    Other proteins in same PDB: d6czxa2, d6czxb2, d6czxc2, d6czxd2
    automated match to d3m5ua_
    complexed with mrd, peg, so4

Details for d6czxb1

PDB Entry: 6czx (more details), 1.57 Å

PDB Description: crystal structure of arabidopsis thaliana phosphoserine aminotransferase isoform 1 (atpsat1) in complex with plp internal aldimine
PDB Compounds: (B:) Phosphoserine aminotransferase 1, chloroplastic

SCOPe Domain Sequences for d6czxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6czxb1 c.67.1.0 (B:72-430) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rvfnfaagpatlpenvllkaqadlynwrgsgmsvmemshrgkeflsiiqkaesdlrqlle
ipqeysvlflqggattqfaalplnlcksddtvdfvvtgswgdkavkeakkycktnviwsg
ksekytkvpsfeeleqtpdakylhicanetihgvefkdypvpkngflvadmssnfcskpv
dvskfgviyggaqknvgpsgvtiviirkdlignaqditpvmldykihdensslyntppcf
giymcglvfedlleqgglkevekknqrkadllynaieesngffrcpveksvrslmnvpft
lekseleaefikeaakekmvqlkghrsvggmrasiynamplagveklvafmkdfqakha

SCOPe Domain Coordinates for d6czxb1:

Click to download the PDB-style file with coordinates for d6czxb1.
(The format of our PDB-style files is described here.)

Timeline for d6czxb1: