Lineage for d6amia_ (6ami A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2480698Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2480699Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2480700Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2480954Protein automated matches [190054] (13 species)
    not a true protein
  7. 2480983Species Pyrococcus furiosus [TaxId:186497] [279274] (15 PDB entries)
  8. 3052278Domain d6amia_: 6ami A: [352340]
    automated match to d1v8zb_
    complexed with llp, na, trp

Details for d6amia_

PDB Entry: 6ami (more details), 1.97 Å

PDB Description: engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb4d11 with trp non-covalently bound
PDB Compounds: (A:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d6amia_:

Sequence, based on SEQRES records: (download)

>d6amia_ c.79.1.1 (A:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetligplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakvylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvshgmlsyflqdeegqikpshsiapgld
ypgvgpehaylkkiqraeyvavtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvs

Sequence, based on observed residues (ATOM records): (download)

>d6amia_ c.79.1.1 (A:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetligplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakvylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvshgmlsyflqdgqikpshsiapgldyp
gvgpehaylkkiqraeyvavtdeealkafhelsrtegiipalesahavayamklakemsr
deiiivnlsgrgdkdldivlkvs

SCOPe Domain Coordinates for d6amia_:

Click to download the PDB-style file with coordinates for d6amia_.
(The format of our PDB-style files is described here.)

Timeline for d6amia_:

  • d6amia_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17