Lineage for d5zltc1 (5zlt C:1-378)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483347Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2483348Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2483853Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2483854Protein automated matches [190965] (28 species)
    not a true protein
  7. 3050943Species Acinetobacter baumannii [TaxId:470] [351005] (3 PDB entries)
  8. 3052276Domain d5zltc1: 5zlt C:1-378 [352338]
    Other proteins in same PDB: d5zlta2, d5zltb2, d5zltc2, d5zltd2
    automated match to d4zhtd_
    complexed with so4, udp

Details for d5zltc1

PDB Entry: 5zlt (more details), 2.5 Å

PDB Description: crystal structure of udp-glcnac 2-epimerase neuc complexed with udp
PDB Compounds: (C:) GDP/UDP-N,N'-diacetylbacillosamine 2-epimerase (Hydrolyzing)

SCOPe Domain Sequences for d5zltc1:

Sequence, based on SEQRES records: (download)

>d5zltc1 c.87.1.0 (C:1-378) automated matches {Acinetobacter baumannii [TaxId: 470]}
mkkiavftgtraeygllywlmrdiqqdpelelqilatamhyspehgetwktivkdgfeit
esvemllssdtssavvksmgvgllgfadalkrmqpdvlvvlgdrfealavtqaalimhvp
vahlhggeitegaydesirhaitkmsnihfaaaeeykkriiqlgeqpervfnvgalgldh
iqrttfksiselselydfdfskpyflityhpetnlleenvaplfdalkqindvnfifsyp
nadngntnivkamldlkaqlpdrvllvksfgiqnylsvlknalamvgnsssglseapalq
vptvnigdrqkgrlrcesildvrldeneivealqkainfpkdqlsqvvpplglgntsqki
ievikttdfkkkapfydl

Sequence, based on observed residues (ATOM records): (download)

>d5zltc1 c.87.1.0 (C:1-378) automated matches {Acinetobacter baumannii [TaxId: 470]}
mkkiavftgtraeygllywlmrdiqqdpelelqilatamhyspehgetwktivkdgfeit
esvemllssdtssavvksmgvgllgfadalkrmqpdvlvvlgdrfealavtqaalimhvp
vahlhggeitegaydesirhaitkmsnihfaaaeeykkriiqlgeqpervfnvgalgldh
iqrttfksiselselydfdfskpyflityhpetnlleenvaplfdalkqindvnfifsyp
nadngntnivkamldlkaqlpdrvllvksfgiqnylsvlknalamvgnsssglseapalq
vptvnigdrqkgrlrcesildvrldeneivealqkainfpplglgntsqkiievikttdf
kkkapfydl

SCOPe Domain Coordinates for d5zltc1:

Click to download the PDB-style file with coordinates for d5zltc1.
(The format of our PDB-style files is described here.)

Timeline for d5zltc1:

  • d5zltc1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17