Lineage for d5xlwb_ (5xlw B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (136 species)
    not a true protein
  7. 2452650Species Mycobacterium tuberculosis [TaxId:83332] [187746] (23 PDB entries)
  8. 3052266Domain d5xlwb_: 5xlw B: [352328]
    automated match to d2gesa_
    complexed with 1pe, edo, peg, so4; mutant

Details for d5xlwb_

PDB Entry: 5xlw (more details), 2.26 Å

PDB Description: mycobacterium tuberculosis pantothenate kinase mutant f247a/f254a
PDB Compounds: (B:) pantothenate kinase

SCOPe Domain Sequences for d5xlwb_:

Sequence, based on SEQRES records: (download)

>d5xlwb_ c.37.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
pspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqvaa
rqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdlv
ttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydiip
gaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtta
aadpeshahhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsinr
lrlrkl

Sequence, based on observed residues (ATOM records): (download)

>d5xlwb_ c.37.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
pspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqvaa
rqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdlv
ttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydiip
gaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamdsqa
vvaareiwrtinrpnlvenilptrpratlvlrkdadhsinrlrlrkl

SCOPe Domain Coordinates for d5xlwb_:

Click to download the PDB-style file with coordinates for d5xlwb_.
(The format of our PDB-style files is described here.)

Timeline for d5xlwb_:

  • d5xlwb_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17