Lineage for d5yf9x_ (5yf9 X:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (17 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (625 PDB entries)
  8. 3052252Domain d5yf9x_: 5yf9 X: [352314]
    automated match to d3at3a_
    complexed with nio, so4

Details for d5yf9x_

PDB Entry: 5yf9 (more details), 1.89 Å

PDB Description: crystal structure of ck2a2 form-2
PDB Compounds: (X:) Casein kinase II subunit alpha'

SCOPe Domain Sequences for d5yf9x_:

Sequence, based on SEQRES records: (download)

>d5yf9x_ d.144.1.7 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agsrarvyaevnslrsreywdyeahvpswgnqddyqlvrklgrgkysevfeainitnner
vvvkilkpvkkkkikrevkilenlrggtniiklidtvkdpvsktpalvfeyinntdfkql
yqiltdfdirfymyellkaldychskgimhrdvkphnvmidhqqkklrlidwglaefyhp
aqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrrepffhgqdnydqlvr
iakvlgteelygylkkyhidldphfndilgqhsrkrwenfihsenrhlvspealdlldkl
lrydhqqrltakeamehpyfypvv

Sequence, based on observed residues (ATOM records): (download)

>d5yf9x_ d.144.1.7 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agsrarvyaevnslrsreywdyeahvpswgnqddyqlvrklgevfeainitnnervvvki
lkpvkkkkikrevkilenlrggtniiklidtvkdpvsktpalvfeyinntdfkqlyqilt
dfdirfymyellkaldychskgimhrdvkphnvmidhqqkklrlidwglaefyhpaqeyn
vrvasryfkgpellvdyqmydysldmwslgcmlasmifrrepffhgqdnydqlvriakvl
gteelygylkkyhidldphfndilgqhsrkrwenfihsenrhlvspealdlldkllrydh
qqrltakeamehpyfypvv

SCOPe Domain Coordinates for d5yf9x_:

Click to download the PDB-style file with coordinates for d5yf9x_.
(The format of our PDB-style files is described here.)

Timeline for d5yf9x_:

  • d5yf9x_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17