Lineage for d5tw8a1 (5tw8 A:25-315)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains)
  6. 2569281Protein automated matches [190161] (24 species)
    not a true protein
  7. 3052139Species Staphylococcus aureus [TaxId:93062] [352201] (3 PDB entries)
  8. 3052242Domain d5tw8a1: 5tw8 A:25-315 [352304]
    Other proteins in same PDB: d5tw8a2, d5tw8b2
    automated match to d3huna1
    complexed with ai8, na, zn

Details for d5tw8a1

PDB Entry: 5tw8 (more details), 1.72 Å

PDB Description: crystal structure of wild-type s. aureus penicillin binding protein 4 (pbp4) in complex with ceftaroline
PDB Compounds: (A:) Penicillin-binding protein 4

SCOPe Domain Sequences for d5tw8a1:

Sequence, based on SEQRES records: (download)

>d5tw8a1 e.3.1.1 (A:25-315) automated matches {Staphylococcus aureus [TaxId: 93062]}
tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvtt
ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqy

Sequence, based on observed residues (ATOM records): (download)

>d5tw8a1 e.3.1.1 (A:25-315) automated matches {Staphylococcus aureus [TaxId: 93062]}
tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvtt
ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
tanynhtittkrgkfrinqvimgagdykggekqrnmmgnalmersfdqy

SCOPe Domain Coordinates for d5tw8a1:

Click to download the PDB-style file with coordinates for d5tw8a1.
(The format of our PDB-style files is described here.)

Timeline for d5tw8a1:

  • d5tw8a1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5tw8a2