Lineage for d5xr0a_ (5xr0 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2406647Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2406648Superfamily b.85.1: AFP III-like domain [51269] (2 families) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. 2406649Family b.85.1.1: AFP III-like domain [51270] (4 protein domains)
    Pfam PF01354
  6. 2406701Protein automated matches [191302] (4 species)
    not a true protein
  7. 2406706Species Zoarces elongatus [TaxId:291231] [255465] (8 PDB entries)
  8. 3052241Domain d5xr0a_: 5xr0 A: [352303]
    automated match to d4ur6a_
    mutant

Details for d5xr0a_

PDB Entry: 5xr0 (more details), 0.98 Å

PDB Description: crystal structure of notched-fin eelpout type iii antifreeze protein a20t mutant (nfe6, afp), p21 form
PDB Compounds: (A:) Ice-structuring protein

SCOPe Domain Sequences for d5xr0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xr0a_ b.85.1.1 (A:) automated matches {Zoarces elongatus [TaxId: 291231]}
gesvvatqlipintaltptmmegkvtnpsgipfaemsqivgkqvntpvakgqtlmpgmvk
tyvpak

SCOPe Domain Coordinates for d5xr0a_:

Click to download the PDB-style file with coordinates for d5xr0a_.
(The format of our PDB-style files is described here.)

Timeline for d5xr0a_:

  • d5xr0a_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17